(data stored in ACNUC7421 zone)

EMBL: AP010803.PE74

AP010803.PE74        Location/Qualifiers
FT   CDS_pept        78078..78374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00740"
FT                   /product="Sel1-like TPR repeat protein"
FT                   /note="FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94908"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX26"
FT                   /protein_id="BAI94908.1"
FT                   /translation="MANGLKSAQFLMESRYAGAAGGTAEACFDLGVAYSCGTGGLPVDL
FT                   IEAHKWFNLAALKGSEEGQTMRAEVAGEMSAREIAEAQRQARALMAATQLRAA"
     atggccaatg gactgaagag cgcgcagttt ctgatggaaa gccggtacgc gggagcggcg        60
     ggcggaaccg cagaggcctg tttcgatctg ggcgtcgcct atagctgcgg cacgggcggc       120
     ctgcccgtcg acctgatcga ggcgcataaa tggttcaatc tcgccgcgct caagggcagc       180
     gaggaagggc agacgatgcg cgcggaagtg gccggggaaa tgtcggcgcg cgaaatcgcc       240
     gaggcgcagc ggcaggcgcg cgcgctgatg gccgcgacgc aattgcgcgc cgcctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page