(data stored in ACNUC7421 zone)

EMBL: AP010803.PE77

AP010803.PE77        Location/Qualifiers
FT   CDS_pept        complement(79472..80605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00770"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94911"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX29"
FT                   /protein_id="BAI94911.1"
FT                   /translation="MARLAQGVAELPRDQWDACAGDANPFMSWDFLTALERSGSVGGHS
FT                   GWQPLPLVIDGPDGRIAAAAPLYGKTHSQGEYVFDHGWADAWERAGGQYYPKIQIASPF
FT                   SPVPGPRLLLRDEALAPALVAGIEAVVEQNGLSSAHATFVAPEQVPLFEAAGWLIREDS
FT                   QFHWTNRGYRDFSDFLADLSSAKRKNIRKERERAVEGLEIVHLTGPALTEAHWDIFWTF
FT                   YQDTGARKWGRPYLTRAFFSLLGESMADRVLLVLALRQGQPIAGALNLIGADTLYGRYW
FT                   GCTEDVPNLHFELCYYQAIDIAIARGLKRVEAGAQGGHKLARGYAPEPTFSAHFIPNDS
FT                   FRRAVADFLAAERQGVQRDRIWLTERTPFRKGEARPD"
     gtggcgcgcc tggcccaagg cgtggccgaa ctgccgcggg accagtggga cgcctgcgcg        60
     ggggacgcca atcctttcat gagctgggat ttcctgaccg cgctggaacg gtccggcagc       120
     gtcggcggcc atagcggctg gcaacccctg ccgctggtga tcgacgggcc ggacgggcgg       180
     atcgccgctg ccgcgccgct ttacggcaag acccacagcc agggcgaata tgtgttcgac       240
     catggctggg ccgacgcctg ggaacgggcg ggcgggcaat attatccgaa gatccagatc       300
     gcctccccct tttcgccggt gccggggccg cgcttgctgc tgcgcgacga ggcgctggcc       360
     ccggcgctgg tcgcggggat agaggcggtg gtggagcaga acgggctgtc atccgcccat       420
     gcgaccttcg tcgcgccgga gcaggtgccg ctgttcgagg cggcgggctg gctgatccgg       480
     gaggacagcc agttccactg gaccaatcgc ggctatcgcg atttcagcga tttcctggcc       540
     gacctgtcga gcgccaagcg caagaatatc cgcaaggaac gcgaacgggc ggtcgagggg       600
     ctggagatcg tccacctgac cggcccggcg ctgaccgagg cgcattggga tattttctgg       660
     accttctatc aggataccgg ggcgcgcaaa tggggccggc cctatctgac ccgcgccttc       720
     ttctccctgc tgggggagag catggccgac cgggtgctgc tggtgctggc gctgcggcag       780
     gggcagccga tcgcgggcgc gctcaacctg atcggcgcgg atacgctgta cggccgctat       840
     tggggctgca ccgaggacgt gcccaacctg catttcgagc tatgctatta tcaggcgatc       900
     gacatcgcca tcgcccgcgg gctgaaacga gtggaggccg gcgcgcaggg cggccacaag       960
     ctggcgcgcg gctatgcgcc ggagccgacc ttctcggccc atttcatccc caatgacagc      1020
     ttccgccgcg ccgtggccga tttcctggcg gcagagcggc agggcgtgca gcgcgaccgg      1080
     atctggctga ccgaaaggac gccctttcga aagggcgagg cgcggccgga ctag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page