(data stored in ACNUC7421 zone)

EMBL: AP010803.PE79

AP010803.PE79        Location/Qualifiers
FT   CDS_pept        complement(81319..81780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00790"
FT                   /product="YjgF-family protein"
FT                   /note="putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94913"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX31"
FT                   /protein_id="BAI94913.1"
FT                   /translation="MSIEARLTELGIALPAAAAPVAAYVAAVEANGLLHISGQISLSDG
FT                   QLMTGRLGEDRDLDYGVKAARACGLNLIAQMKAALGSLDRVERIVKLGAFISSTPEFTD
FT                   QPKVANGASELMVDVFGEAGKHARSAVGVPVLPLGAAVEIDAIVLVRPA"
     atgagcatcg aagcccgcct gaccgaactg ggcatcgccc ttcccgccgc cgccgcgccg        60
     gtcgccgcct atgtcgcggc ggtggaggcg aacggcctgc tgcatatctc cggccagatc       120
     tcgctgtccg acggccagtt gatgaccggc cgcctgggcg aggaccgcga cctggactat       180
     ggcgtcaagg cggcgcgcgc ctgcggcctg aacttgatcg cccagatgaa ggcggcgctg       240
     ggcagcctgg accgggtcga gcggatcgtg aagctgggcg ccttcatcag cagcacgccc       300
     gaattcaccg accagcccaa ggtcgccaat ggcgcgtccg aactgatggt cgatgtcttc       360
     ggcgaggcgg gcaagcatgc ccgcagcgcc gtgggggttc cggtgctgcc gctgggcgcg       420
     gcggtagaga tcgacgcgat cgtccttgtc cgcccggcct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page