(data stored in ACNUC7421 zone)

EMBL: AP010803.PE8

AP010803.PE8         Location/Qualifiers
FT   CDS_pept        4968..5477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00080"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein, possibly involved in
FT                   aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94842"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW0"
FT                   /protein_id="BAI94842.1"
FT                   /translation="MPCSPVARRVTQPDRESAASALPSGEEAHFRALESLYRSAPINRL
FT                   FRSQLTIPEEGRSIIHFDVDETQFHAAGAVHGTVYFKMLDDAAFYAANSLVSDRFLLTT
FT                   SFNLLFTRPIGPGRIRAEGRWISGRRRVYVAEASLIDADGEEVGRGTGTFMRSQFPLSS
FT                   LPGYAD"
     atgccctgct cgccggtggc gaggcgcgtg acgcagcctg atcgggaatc ggccgccagc        60
     gccctgccca gcggggagga ggcgcatttc cgggcgctgg agtctctcta ccgctccgca       120
     ccgatcaacc ggctgttccg gtcccaactg acgatcccgg aagaaggccg gtcgatcatc       180
     catttcgacg tggacgagac ccagttccac gcggcggggg cggtgcacgg cacggtctat       240
     ttcaagatgc tggacgatgc ggccttctac gccgccaaca gcctggtcag cgaccgtttc       300
     ctgctgacga ccagcttcaa cctgctgttc acccgcccga tcgggccggg ccgcatcagg       360
     gcggaagggc gctggatcag cggcaggcgg cgcgtctatg tcgcggaagc cagcctgatc       420
     gatgccgatg gcgaggaggt cgggcgcggc accggcacct tcatgcggtc gcaattcccc       480
     ttgtcgtccc tgcccggcta tgccgactga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page