(data stored in ACNUC7421 zone)

EMBL: AP010803.PE80

AP010803.PE80        Location/Qualifiers
FT   CDS_pept        complement(81777..82448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94914"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX32"
FT                   /protein_id="BAI94914.1"
FT                   /translation="MNRPLIITDCDEVLLHMVVPFREWLDESHDIHFDMHDRGFGEALR
FT                   HKDSGQPVERALVWELLLGFFETQMHRQTPIAGAVEAMGRLGRIADIVVLTNITERHHL
FT                   QRIEQLAAHGLDLPVHWNQGGKGEPLAAILAERQPGVALFIDDLAQHHASVADHAPGVW
FT                   RLHMVGEPQIAASVPVAPLAHARIDDWAAAEAWIAARLAEGPAPETPAPQGSPTIQGAS
FT                   A"
     atgaaccgtc ccctgatcat caccgattgc gacgaggtgc tgctgcacat ggtcgttccc        60
     tttcgcgaat ggctggacga gagccatgac atccatttcg acatgcacga ccgcggcttc       120
     ggcgaggcgc tgcgccacaa ggatagcggg cagccggtgg agcgggcgct ggtctgggaa       180
     ctgctgctgg gctttttcga gacgcagatg caccgccaga cgccgatcgc cggagcggtg       240
     gaggccatgg gacgccttgg ccggatcgcc gacatcgtgg tcctgaccaa catcaccgaa       300
     cggcatcatc tccagcgcat cgaacaactc gccgcccacg ggctcgacct gccggtgcac       360
     tggaaccagg gaggcaaggg cgaaccgctg gccgccatcc tggcggagcg ccagcccggc       420
     gtcgccctgt tcatcgacga tctggcgcag catcatgcat ccgtggcgga ccatgcgccc       480
     ggcgtctggc gcctgcacat ggtgggcgag ccgcagatcg ccgccagcgt ccccgtcgcg       540
     ccgctggccc atgcccggat cgacgactgg gccgccgccg aagcctggat cgcggcccgg       600
     ctggccgaag ggccggcgcc tgaaaccccg gcgccccagg gcagcccgac catccaagga       660
     gcatccgcat ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page