(data stored in ACNUC7421 zone)

EMBL: AP010803.PE81

AP010803.PE81        Location/Qualifiers
FT   CDS_pept        complement(82445..82741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94915"
FT                   /db_xref="InterPro:IPR021955"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX33"
FT                   /protein_id="BAI94915.1"
FT                   /translation="MRPDINHGKQHSRSETREPSVLALMALAWTLADDRRADRLLALTG
FT                   LDADALRAGVADPAILGAVLGFLADHEPDLIACAESIDSSPEALITAKERLAA"
     atgcgtcccg acattaacca tggcaagcag catagtcgaa gcgagacccg agagccatcc        60
     gtgctggccc tgatggcgct ggcctggacg ctggcggacg accgccgcgc cgaccggctg       120
     ctggcgctga ccgggctgga cgcagatgcg ctgagggcgg gggtggccga tccggcgata       180
     ttgggcgcgg tgctgggctt cctggccgat catgagccgg acctgatcgc ctgcgcggaa       240
     agcatcgaca gcagcccgga agcgctgata acggcaaagg agcgtcttgc cgcatga          297
//

If you have problems or comments...

PBIL Back to PBIL home page