(data stored in SCRATCH zone)

EMBL: AP010803.PE88

AP010803.PE88        Location/Qualifiers
FT   CDS_pept        88004..88318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94922"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX40"
FT                   /protein_id="BAI94922.1"
FT                   /translation="MGDWGVWRTSPFLPIERWGGGPPLKAVVEGNGARPPNFLSTSAAP
FT                   TSKRVTCLSSTLLTLRVGRNGDGPWPCSCLRGSMLRWGQGSIHHSHPCRDRGGASLDIA
FT                   "
     atgggtgatt ggggtgtttg gcggacctct cctttcctcc ccatcgagag atggggaggg        60
     ggaccgccgc tgaaagcggt ggtggagggg aatggggcac gacctccgaa tttcctctcc       120
     acatcggctg cgccgacgtc gaagagagtc acgtgcctct cttcgaccct cctcacgctg       180
     cgcgtaggga ggaatgggga tggcccatgg ccgtgttcct gccttcgcgg gagcatgttg       240
     cgctggggac aaggaagtat acatcatagc catccttgcc gtgacagggg cggcgcatca       300
     ttggacatcg catga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page