(data stored in ACNUC7421 zone)

EMBL: AP010803.PE89

AP010803.PE89        Location/Qualifiers
FT   CDS_pept        88315..88974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00890"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94923"
FT                   /db_xref="GOA:D4YX41"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX41"
FT                   /protein_id="BAI94923.1"
FT                   /translation="MTKLRLALLPLLAVPASLAAAPAANWLARIALSPIGGHVLGNPGA
FT                   PTKLVEYVSYTCSHCAHFVKEASEPLRAGYVKGGKVSVEVRNAVRDKYDLAAALLARCG
FT                   GPGRFFGNHEALFANQDAWMEKLIAYDKDATKPTEEKAALRDIGQKTGLYALMGKRGFK
FT                   PAQLDACIDDPASMKQILAMTDEAWNKLRIGGTPAFTLNGALVHGSDWTRLQAALP"
     atgacgaaac tccgcctggc cctccttccc ctgctcgccg tcccggcgag ccttgccgcc        60
     gccccggccg ccaactggct ggcccggatc gccctttccc cgatcggcgg ccatgtgctg       120
     ggcaatcccg gcgcgccgac gaagctggtc gaatatgtga gctacacatg ctctcactgc       180
     gcccatttcg tgaaagaggc gagcgaaccg ctgcgcgccg gatatgtgaa gggcggcaag       240
     gtcagcgtcg aggtgcgcaa cgccgtgcgc gacaaatatg acctggccgc cgccctgctg       300
     gcccgttgcg gcgggcccgg ccgcttcttc ggcaatcatg aggcgctgtt cgccaaccag       360
     gacgcctgga tggaaaagct gatcgcctat gacaaggacg cgaccaagcc gaccgaggaa       420
     aaggccgccc tgcgcgacat cgggcagaag accggcctct atgcgctgat gggcaagcgc       480
     gggttcaagc ccgcgcaact ggacgcctgc atcgacgacc ccgcgtcgat gaagcagatc       540
     ctcgccatga ccgacgaagc ctggaacaag ctgcggatcg gcggcacgcc tgccttcacg       600
     ctgaacggcg cgctggtcca cgggtcggac tggacgcggt tgcaggccgc attgccctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page