(data stored in SCRATCH zone)

EMBL: AP010803.PE9

AP010803.PE9         Location/Qualifiers
FT   CDS_pept        5506..5817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00090"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94843"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW1"
FT                   /protein_id="BAI94843.1"
FT                   /translation="MLVGALTRRCAAAGGFATVLVKGDEISGSILLQTLEKGREQGLFE
FT                   RVPDYAGGYRLVRCGPDTEKGQEAMAQYLARRRGSDPDLWVIELDIADAERFAAETIC"
     atgctggtcg gcgcgctgac gcgccgctgc gccgcggcgg gcggcttcgc cacggtgctg        60
     gtgaaggggg acgagatcag cggctccatt ctgctccaga cgttggaaaa ggggcgggaa       120
     cagggcctgt tcgagcgcgt tcctgattat gcgggcggct acaggctggt ccgctgcggc       180
     cccgatacgg aaaaggggca ggaggccatg gcccaatatc ttgcgcgtcg gcgtggatcg       240
     gaccccgatc tgtgggtcat tgaactcgac atcgcggatg cggaacggtt cgccgctgaa       300
     acgatctgtt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page