(data stored in ACNUC7421 zone)

EMBL: AP010803.PE90

AP010803.PE90        Location/Qualifiers
FT   CDS_pept        89030..89764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00900"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94924"
FT                   /db_xref="GOA:D4YX42"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX42"
FT                   /protein_id="BAI94924.1"
FT                   /translation="MKALSGLALIALSLTVAACGKKEEGGATSAQPVAAVAAPAGTTWS
FT                   ETIAATPEGYFLMGNPDAKVKLVEYGSYTCSHCRDFAAESAEEIRQIVDSGKMSFEFRN
FT                   YVRDPIDISTALLARCGGKDIFYPLSDQFFANQNAMFEKAQALGDERYKALMSAPPAQR
FT                   FGQLAEAIGLVDFAKQRGIAEDQAKQCLADTAAAEKLAKTVEDANRQYKIEGTPTFILN
FT                   GVMVENTAAWPALRAKLKEAGI"
     gtgaaagccc tttccggact tgccctgatc gccctcagcc tgaccgtcgc cgcctgcggc        60
     aagaaggagg agggcggcgc cacctccgcc cagccggtcg ccgccgtggc cgcgccggcc       120
     ggcaccacat ggtcggagac tatcgccgcg acgcccgagg gctatttcct catgggcaat       180
     cccgatgcga aggtgaagct ggtcgaatat ggctcctaca cctgctcgca ctgccgcgac       240
     ttcgccgccg aatcggcgga ggagatcagg cagatcgtcg acagcggcaa gatgagcttc       300
     gaattccgca actatgtgcg cgatccgatc gacatctcga cggcgctgct ggcccgttgc       360
     ggcggcaagg acatattcta tccgctgtcc gaccagttct tcgccaacca gaacgcgatg       420
     ttcgaaaagg cgcaggccct gggcgacgaa cggtacaagg cgctgatgag cgcgccgccc       480
     gcccagcgat tcggccagct tgctgaggcc atcggcctgg tcgacttcgc caagcagcgc       540
     ggcatagcgg aggatcaggc gaagcaatgc ctggccgaca ccgccgccgc cgaaaagctg       600
     gccaagacgg tcgaggacgc caatcggcaa tataagatcg aaggcacgcc gaccttcatc       660
     ctgaacggcg tgatggtgga gaacaccgcc gcctggccgg cgttgcgcgc gaagctcaag       720
     gaagcgggga tctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page