(data stored in ACNUC7421 zone)

EMBL: AP010803.PE96

AP010803.PE96        Location/Qualifiers
FT   CDS_pept        complement(98147..99442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00960"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94930"
FT                   /db_xref="GOA:D4YX48"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX48"
FT                   /protein_id="BAI94930.1"
FT                   /translation="MTNPADPCPKSAVSHGVGMAGLVGLGLWTLVARHYGMNGPNAGFA
FT                   AVAACGLPMVLWSLLVDKVHRRASTGIDWTAPARPWRAVLDVSIVKIAGLWATWLAIAV
FT                   FYCIARWYWSGDYRLSMNVLMGAAPWLLAASVPYVIWLDRRLIEPRDASHAFGQWVIGG
FT                   AAGAPDKAEVAHHARAWAVKGFFLAFMLSIVPGNFASVVDLRIEEAFGHPVALASFLIA
FT                   VMFMIDVCMATVGYMLTMKPLDSHIRTANPLLAGWVAALICYPPFVLMGNGGPIDYHAG
FT                   GAEWDVWTRGHEALQWLLGGWLVLLTAIYAWATVAFGLRFSNLTHRGILTHGPYRWTRH
FT                   PAYLSKNLFWWFSALPFLSLSGSLTDVVRNCALLGVTNAVYYWRAKTEEAHLGADPEYR
FT                   AYSDWMERNGAVPRFFAWIAGRKAVGLAQPAE"
     atgaccaacc ctgccgatcc ctgcccgaaa tccgccgtca gccacggcgt cggtatggcc        60
     gggctggtcg gactggggct ttggacgctt gtggcgcggc attatggcat gaacgggccg       120
     aatgcgggct ttgccgccgt cgccgcctgc ggcctgccga tggtgctgtg gtcgctgctg       180
     gtcgacaagg tgcatcgccg cgcatcgacc gggatcgact ggaccgcgcc tgcgcggcca       240
     tggcgggccg tgctggatgt cagcatcgtc aagatcgccg gcctgtgggc cacctggctt       300
     gccatcgcgg tcttctattg catcgcccgc tggtattgga gcggggatta tcgcctttcc       360
     atgaatgtgc tgatgggcgc ggcgccatgg ctgctggcgg cgtcggtgcc ctatgtgatc       420
     tggctggacc ggcgcctgat cgagccgagg gacgccagcc atgccttcgg ccaatgggtg       480
     atcggcgggg ccgccggcgc gccggacaag gccgaggtcg cccatcatgc ccgcgcctgg       540
     gcggtgaagg gctttttcct cgccttcatg ctgtcgatcg tgccgggcaa tttcgccagc       600
     gtggtcgatt tgcggatcga ggaggcgttc ggccatcccg tggcgctggc cagtttcctg       660
     atcgcggtca tgttcatgat cgacgtctgc atggcgaccg tcggctatat gctgacgatg       720
     aagccgctgg attcgcatat ccgcacggcc aatccattat tggccgggtg ggtggcggcg       780
     ctgatctgct atccgccctt cgtgctgatg ggcaatggcg gcccgatcga ttatcatgcg       840
     ggcggggctg aatgggatgt ctggacgcgg gggcatgaag ccctgcaatg gctgctgggc       900
     ggctggctgg tgttgctgac ggccatctat gcctgggcga cggtggcttt cgggctgcgt       960
     ttctccaacc tgacgcatcg ggggatcctg acccacgggc cgtatcgctg gacgcggcat      1020
     ccggcctatc tgtcgaaaaa tctgttctgg tggttttccg ccctgccttt cctgagcctg      1080
     tcgggcagcc tgaccgacgt ggtacggaac tgcgccctgc tgggcgtgac caacgcggtc      1140
     tattattggc gcgcgaagac cgaggaggcg catttgggcg ccgatccgga atatcgcgcc      1200
     tatagcgact ggatggaacg caatggcgcc gtaccgcgct tctttgcgtg gattgcgggg      1260
     cggaaggccg tggggctggc gcagcctgcc gaatga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page