(data stored in ACNUC7421 zone)

EMBL: AP010803.PE97

AP010803.PE97        Location/Qualifiers
FT   CDS_pept        complement(99653..100279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00970"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94931"
FT                   /db_xref="GOA:D4YX49"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX49"
FT                   /protein_id="BAI94931.1"
FT                   /translation="MSRSRIFPWRYGMFLALLASMAPLGLLLPWHEAVMAGFDLAALAF
FT                   ILSAWPLLDSDADAMRRKAAENDANRRLMLLLTAIVSVVILVAVGVAVSQHGGPSRAAI
FT                   ALLLATLALAWLFSNLVYAMHYAHIFYLDDGKGGDSGGLDFPGMREPDYWDFLYFAFTL
FT                   GMTFQTSDVSVTSRSMRQAALFHCLAAFLFNLGILAFTINVLGGG"
     atgagccggt cgcggatatt tccctggcgt tatggcatgt tcctggccct gctggcgagc        60
     atggcgccct taggcctcct gcttccatgg catgaggcgg tgatggcggg gttcgacctt       120
     gcggcgctgg cgttcatcct gtccgcctgg ccgctgctgg attccgatgc ggacgcgatg       180
     cggcgcaagg cggcggaaaa cgacgcgaac cggcgattga tgctgctgct gaccgcgatc       240
     gtgtcggtgg tgatcctggt cgccgtgggc gtggcggtca gccagcatgg cgggccgagc       300
     cgggcggcga tcgcgctgtt gctcgcgacg ctggcgctgg cctggctgtt ttccaacctc       360
     gtctatgcga tgcactatgc gcacatcttc tatctggacg atgggaaggg cggcgacagc       420
     ggcgggcttg attttcccgg catgcgggag ccggactatt gggacttcct ctatttcgcc       480
     ttcacattgg ggatgacgtt ccagacatcc gacgtgtcgg tgaccagccg gagcatgcgg       540
     caggcggcgc tgttccattg cctggcggcg ttcctgttca acctgggaat attggcgttc       600
     accatcaatg tgctgggtgg gggataa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page