(data stored in ACNUC7421 zone)

EMBL: AP010803.PE98

AP010803.PE98        Location/Qualifiers
FT   CDS_pept        complement(100321..100896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00980"
FT                   /product="hypothetical protein"
FT                   /note="protease subunit of ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94932"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX50"
FT                   /protein_id="BAI94932.1"
FT                   /translation="MSMQAPLLGPRDFEYPAIMLSGYVDHGMYLHFRNCLSSAPQQGLV
FT                   VVEIATLGGDPEIARMMGEDIRFHSDLYPDRRLVFLGKTAVYSAGATFMSFFAAENRYL
FT                   ARGTRLMIHERIITRDIHLEGPLSTCIASLKATLHEIEASISIQNEGFANLILGSQVSM
FT                   EELLNRAPENWYLEASEAQALGLIAAVI"
     atgtcgatgc aggcgccatt gctgggcccc agggatttcg aatatcccgc gatcatgctg        60
     tcgggctatg tcgaccatgg catgtatctg catttccgca attgcctttc ctccgcgccg       120
     cagcaggggc tggtggtggt ggagatcgcc accttgggcg gcgacccgga aatcgcgcgg       180
     atgatggggg aggatatacg cttccattcc gatctctatc ccgaccgacg gctggtgttc       240
     ctgggcaaga cggcggtcta ttcggcgggc gcgaccttca tgagcttctt cgcggcggag       300
     aaccgctatc tggcgcgggg cacgcggctg atgatccacg aacgcatcat cacgcgggac       360
     atccatctgg aaggaccgct gtcgacctgc atcgcttcgc tcaaggccac gctgcatgag       420
     atagaggcgt cgatctcgat ccagaatgaa ggtttcgcca acctgatcct gggatcgcag       480
     gtttccatgg aggaactgct gaaccgcgcg ccggagaact ggtatctgga agcgagcgag       540
     gcgcaggcgc tggggctgat cgctgccgta atataa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page