(data stored in ACNUC7421 zone)

EMBL: AP010803.PFKB

AP010803.PFKB        Location/Qualifiers
FT   CDS_pept        327718..328719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="SJA_C1-03120"
FT                   /product="ribokinase family sugar kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95146"
FT                   /db_xref="GOA:D4YXR4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR4"
FT                   /protein_id="BAI95146.1"
FT                   /translation="MTAAAPTLDVVAIGNAIVDVLARSDDAFLAEHALTKGGMQLIDAE
FT                   TAESLYADMGAGKEISGGSAANTLAGLAALGKKCGFIGQVNDDQLGAVFAHDVRALGIR
FT                   YDTPAMRGDVPTARCLILVTPDAQRTMNTFLGASQFLPEAALDLDLIRSASILYLEGYL
FT                   WDPEQPRAAMRAAIDAARGAGRKVAFTLSDNFVIDRHRSDFLDLIDQGLIDILFSNEGE
FT                   IQSLAGVHDFDAAVAAIAPKVPVLVSTRSEKGAIAVVEGLRYEAHAAPVAEVIDTTGAG
FT                   DLFAAGFLAGHLEGLEVDKCLKLGAAAAAEVISHWGARPEEDLKAIRAKTLG"
     gtgaccgctg ctgcccccac gcttgatgtt gtcgccatcg gcaacgccat tgtcgacgtg        60
     ctcgcccgga gcgacgacgc tttcctggcc gaacatgcgc tgaccaaggg cggcatgcag       120
     ttgatcgacg cggaaaccgc cgaaagcctc tatgccgaca tgggcgcggg caaggagatc       180
     agcggcggat cggcggcgaa cacgctggcg gggctggccg cgctcggcaa gaaatgcggt       240
     ttcatcgggc aggtcaatga cgatcagttg ggcgccgtct tcgcccatga cgtgcgcgcg       300
     ctcggcatcc gctacgatac gccggcgatg cggggcgacg tgccgacggc gcgctgcctg       360
     atcctggtga cgcccgacgc gcagcggacg atgaacacct ttttgggcgc gtcgcaattc       420
     ctgccggagg ccgcgctgga cctggacctt atccgttccg cctcgatcct ctatctggaa       480
     ggctatctct gggatccgga gcagccgcgc gcggcgatgc gcgccgcgat cgacgcggcg       540
     cggggcgcgg ggcggaaggt cgccttcacc ctgtcggaca atttcgtgat cgaccgccat       600
     cgctccgact tcctcgacct gatcgaccag gggctgatcg acatcctctt ctccaatgaa       660
     ggggaaatcc agtcgctggc cggggtgcat gatttcgacg ccgccgtggc cgccatcgcc       720
     ccgaaggtgc cggtgctggt ctcgacccgc agcgagaaag gcgcgatcgc cgtggtagag       780
     ggcctgcggt acgaagcgca tgcggccccg gtggccgaag tgatcgacac gaccggggcg       840
     ggcgacctgt tcgcggcggg attcctggcc ggtcatctgg aggggctgga ggtcgacaag       900
     tgcctgaaac tgggcgcggc ggcggcggcc gaagtgatct cccactgggg ggcgcggccg       960
     gaggaggact tgaaggcgat ccgggcgaag acgctgggat aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page