(data stored in ACNUC7421 zone)

EMBL: AP010803.PHZ

AP010803.PHZ         Location/Qualifiers
FT   CDS_pept        complement(178151..178945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phz"
FT                   /locus_tag="SJA_C1-01700"
FT                   /product="phenazine biosynthesis protein"
FT                   /note="putative epimerase, PhzC/PhzF homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95004"
FT                   /db_xref="GOA:D4YXC2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC2"
FT                   /protein_id="BAI95004.1"
FT                   /translation="MPVTSLPIIQVDAFADAPFTGNPAAVMPLGQWLDDATLQAIAAEN
FT                   NLSETAFTVPTPDDPEADYALRWFTPAVEVKLCGHATLASGHVLMGGRTAVRFRTRQAG
FT                   ILSVSRDRDGYALSLPAWPTGPTPLPELAEAMGGDILETQWREGGYAIFLYRDAAAIRA
FT                   LEPDFATLKKAGPILLIATAPGDDSDIVSRVFVPGAGIDEDPVTGSAHCLLTPYWAKRL
FT                   DKAALTAFQASRRGGRLSCRLSGDRVILTGACRTVIEGNFLL"
     ttgcccgtga ccagcctgcc catcatccag gtcgacgcct tcgccgacgc gcccttcacc        60
     ggcaatccgg ccgcggtcat gccgctcggc caatggctgg acgatgcgac gcttcaggcg       120
     atagcggcgg aaaacaacct ctccgaaacc gccttcaccg tgcccacccc cgacgatccg       180
     gaggcggact atgcgctgcg ctggttcacg ccggccgtgg aggtcaagct ctgcggccat       240
     gccacgctgg cgagcggcca tgtgctgatg ggcgggcgca ccgccgtccg cttccgcacg       300
     cggcaggcgg gcatcctcag cgtgtcgcgc gaccgcgacg gctatgccct ctcccttccc       360
     gcctggccta ccggacccac gcccttgccc gaactggccg aggccatggg cggggacatc       420
     ctggaaaccc aatggcgcga agggggctat gcgatcttcc tttatcgcga cgcggccgcg       480
     atccgtgcgc tggaaccgga cttcgcgacg ttgaagaagg ccggtcccat cctgctgatc       540
     gccaccgcgc ccggcgatga cagcgacatc gtcagccgcg tcttcgtccc cggcgcgggc       600
     atagacgaag atcccgtcac cggctccgcc cattgcctgc tcacccctta ttgggcgaaa       660
     cggctggaca aggccgcgct cacggccttt caggcatcgc ggcgcggcgg gcgcctgtcg       720
     tgccggcttt ccggcgacag ggtgatcctg accggcgcct gccgcacggt gatcgaaggc       780
     aatttcctgc tttaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page