(data stored in ACNUC7421 zone)

EMBL: AP010803.PLD

AP010803.PLD         Location/Qualifiers
FT   CDS_pept        complement(93325..94782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plD"
FT                   /locus_tag="SJA_C1-00920"
FT                   /product="phospholipase D"
FT                   /EC_number="3.1.4.4"
FT                   /note="phospholipase D /
FT                   phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase or related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94926"
FT                   /db_xref="GOA:D4YX44"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX44"
FT                   /protein_id="BAI94926.1"
FT                   /translation="MSGPREGEDCWRIARALKASVIVDADAYFRHARAAMMKAKRRIML
FT                   IGWDFDAAITLIREDEASDGAPTVIGDFISWLVERTPELEIFLLRWDVGAMKSMARPSN
FT                   LFTTVRWMVNPRITVKLDSHHPTAASHHQKIVVIDDCFAFCGGIDMTGDRWDTRHHRDG
FT                   EPWRRHPDGSPYGPWHDATTALQGPVAAALGQHARARWKGAGGGELPPVEGQQDCWPDA
FT                   LPVQFEDVDIAISRSAPEMEDQEPLIEIERLYVNQIAAARRHIYAESQYFASRRIAEAI
FT                   AARLAEEDGPEIVIVNPEQADGWLEQQAMDTARARLFEALKARDAHGRFRLYHPFTARG
FT                   EPIYVHAKILIVDDRVLRVGSSNMNNRSMRLDTECDVTIDAALPANAGREDAIRAIRDD
FT                   LIAEHLDLPVERVAAVIAEQGLIAAIEQLRDRPGRTLRPYVTPDLNGVQAWLADNEALD
FT                   PEGPGEMLEPITERGLFRRMRGWMEGD"
     atgagcggcc cgcgcgaggg ggaggattgc tggcggatcg cgcgagcgct gaaggccagc        60
     gtgatcgtcg atgcggacgc ctatttccgc catgcccgcg ccgcgatgat gaaggcgaag       120
     cggcggatca tgctgatcgg ctgggatttc gacgccgcca tcacgctgat ccgcgaggat       180
     gaggcgagcg acggcgcgcc gacggtgatc ggggacttca taagctggct ggtggagcgg       240
     acgccggagc tggaaatctt cctgctgcgc tgggacgtgg gggcgatgaa gtcgatggcg       300
     cggccgtcca acctgttcac cacggtccgc tggatggtca atccgcggat cacggtgaag       360
     ctggacagcc atcacccgac cgccgcctcc catcatcaga agatcgtggt gatcgacgat       420
     tgcttcgcct tttgcggcgg gatcgacatg accggcgacc gctgggacac gcggcatcac       480
     cgcgacgggg aaccgtggcg gcggcatccg gacggatcgc cctatggtcc ctggcatgat       540
     gcgaccacgg ccttgcaggg ccccgtggcg gcggcgctgg ggcaacatgc gcgggcgcgg       600
     tggaagggtg cgggcggcgg ggaactgccg ccggtcgaag gccagcagga ttgctggccc       660
     gatgcgctgc cggtgcagtt cgaggatgtg gacatcgcca tatcccgttc cgcgccggag       720
     atggaggatc aggaaccgct gatcgagatc gagcggctct atgtgaacca gatcgcggcg       780
     gcgcggcgcc atatctacgc agagagccaa tatttcgcct cccgccgcat tgcagaggcg       840
     atcgcggcgc ggctggcgga agaggacggg ccggaaatcg tcatcgtcaa tccggagcag       900
     gccgacggct ggctggagca gcaggcgatg gacacggccc gcgcccggct gttcgaggcg       960
     ctgaaggcgc gggacgccca tggccggttc cggctctatc atcccttcac ggcgcggggg      1020
     gagccgatct atgtccatgc caagatattg atcgtcgacg accgggtgct gcgcgtcgga      1080
     tcgtccaaca tgaacaaccg atcgatgcgg ctggacaccg aatgcgacgt gacgatcgac      1140
     gcggcgctgc ccgccaatgc ggggcgggaa gatgcgatcc gcgccattcg cgacgatctg      1200
     atcgcggagc atctcgacct gccggtcgag cgggtggcgg cggtgattgc cgaacagggg      1260
     ctgatcgccg ccatcgaaca gctgcgcgac aggccgggac ggaccttgcg gccctatgtg      1320
     acgccggatc tgaacggcgt gcaggcatgg ctggcggaca atgaggcgct cgatccggaa      1380
     ggaccgggcg aaatgctgga gccgatcacg gagcgcggac ttttccggcg gatgcgggga      1440
     tggatggagg gggattaa                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page