(data stored in ACNUC7421 zone)

EMBL: AP010803.PRFA

AP010803.PRFA        Location/Qualifiers
FT   CDS_pept        61837..62928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="SJA_C1-00630"
FT                   /product="peptide chain release factor RF-1"
FT                   /note="protein chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94897"
FT                   /db_xref="GOA:D4YX15"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX15"
FT                   /protein_id="BAI94897.1"
FT                   /translation="MHISAERIAQIEARRDEVQASMTRADLAPEEFVRLSKEYAEIEPV
FT                   AKAAHEVRRLRQELSALEYMAGGEDADSDPLMREMAQEEMQLIKSRLPDAERALALQLL
FT                   PKDAADARPAMLEIRAGTGGDEAALFAGDLFRMYQRYADAQGWKMELISANASEVGGYK
FT                   EVVASVTGTGVFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEPEEVDVQIADS
FT                   DLKIDIYRASGAGGQHVNTTDSAVRITHLPSGIVVTQQDERSQHKNKAKAMQVLRARIY
FT                   EAERERAQSEQAGARKAMVGSGDRSERIRTYNFPQGRVTDHRINLTLHRLPEILEGPGL
FT                   SEVIDALVAEDEAARLAQLDGVA"
     atgcacatct ccgccgaacg catcgcgcag atcgaggcgc gccgggacga ggtgcaggcg        60
     tcgatgacgc gtgccgacct cgcgccggag gagttcgtgc ggctgtccaa ggaatatgcg       120
     gagatcgagc cggtggcgaa ggccgcccat gaggtccgcc gcctgcgcca ggaactgagc       180
     gcgctggaat atatggcggg cggcgaggat gcggattccg atccgctgat gcgcgaaatg       240
     gcgcaggaag agatgcaact gatcaagagc cggttgcccg acgccgaacg cgccctcgcg       300
     ctgcaattgc tgccgaagga tgccgccgac gcccgcccgg ccatgctgga aatccgcgca       360
     ggcaccggcg gcgacgaagc cgcgctgttc gcgggcgacc tgttccgcat gtaccagcgc       420
     tatgccgacg cgcagggctg gaagatggaa ctcatttccg ccaacgcttc cgaagtcggg       480
     gggtataagg aggtcgtcgc cagcgtcacc ggcaccggcg tcttcgccaa gctgaagttc       540
     gaaagcggcg tccatcgcgt ccagcgcgtg cccgtcaccg aaagcggcgg gcgcatccac       600
     acctccgccg ccaccgtcgc ggtgctgccg gaaccggagg aggtcgacgt ccagatcgcc       660
     gacagcgatc tcaagatcga catctaccgg gcgtccggcg cgggcggcca gcatgtcaac       720
     accaccgact ccgccgtgcg catcacgcac ttgcccagcg gcatcgtcgt gacgcagcag       780
     gacgaacgat cccagcacaa gaacaaggcg aaggcgatgc aggttctgcg cgcccgcatc       840
     tacgaagcgg aacgcgaacg cgcccagagc gaacaggcgg gcgcgcgcaa ggcgatggtc       900
     ggctccggcg accgttccga acgcatccgc acctataatt tcccgcaagg ccgggtgacg       960
     gaccaccgca tcaacctgac cctgcaccgc ctgcccgaaa tcctggaagg accgggcctg      1020
     tccgaagtca tcgacgcgct ggtggcggag gacgaagccg cccgcctcgc ccaactggac      1080
     ggcgtggcgt ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page