(data stored in ACNUC7421 zone)

EMBL: AP010803.PTSN

AP010803.PTSN        Location/Qualifiers
FT   CDS_pept        4466..5008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="SJA_C1-00070"
FT                   /product="PTS system nitrogen regulatory IIA component"
FT                   /note="phosphotransferase system mannitol/fructose-specific
FT                   IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94841"
FT                   /db_xref="GOA:D4YWV9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV9"
FT                   /protein_id="BAI94841.1"
FT                   /translation="MGPDFKDPGIASIFPKLGAARLGFGMVHFNDIVAPDALGTALSVN
FT                   GKKQLFQKVATLAAQAYGLEADMVAEALLEREKLGSTGFGGGVAIPHAKIPGLQKMCGV
FT                   VVLLDPVVPFDAVDEAPVDIVFALLSPIDSGAEHLKTLARVSRYLRDEGQVARLRGAKS
FT                   TAALHALLAGGEARDAA"
     atggggccgg actttaaaga tccgggcatt gcgtcaattt ttccgaagct gggcgcggct        60
     cggctgggat tcggcatggt tcatttcaac gatatcgtcg caccggatgc attgggcacc       120
     gccctttcgg tgaacggcaa gaagcagttg tttcagaagg ttgcgacgct ggctgcccag       180
     gcctacggcc tggaagcgga tatggtggcg gaagcgctgc tggagcgcga gaagctgggg       240
     tctaccggct ttggcggcgg agtcgcgatt ccccatgcga agattccggg ccttcagaaa       300
     atgtgcggcg tggtcgtcct gctcgacccg gtggttccct tcgacgcggt agacgaagcg       360
     ccggtggaca tcgtcttcgc gctcctctcc ccgatcgatt cgggcgccga gcatctcaag       420
     acgctggccc gcgtctcgcg ctacctgcgc gacgaggggc aggtcgcccg gttgcgcggc       480
     gccaagtcga cggcggcgct tcatgccctg ctcgccggtg gcgaggcgcg tgacgcagcc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page