(data stored in ACNUC7421 zone)

EMBL: AP010803.PURH

AP010803.PURH        Location/Qualifiers
FT   CDS_pept        316422..318011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SJA_C1-03000"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="bifunctional purine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95134"
FT                   /db_xref="GOA:D4YXQ2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ2"
FT                   /protein_id="BAI95134.1"
FT                   /translation="MSDVTIKRALLSVSDKSGLIELGQALGRHGVELVSTGGTAKALRE
FT                   AGLAVKDISDLTGFPEMMDGRVKTLHPKVHGGLLAVRGNAEHVAAMQAHDIGAIDLVVV
FT                   NLYPFAATVAKGADREEIIENIDIGGPSMVRSAAKNHESVAIVTDPADYARLVAEMEEK
FT                   GGATSYDFRRMLAAKAYAATAAYDSMIASWFAFADQGAQFPESLSVSSRLGSTLRYGEN
FT                   PHQSAALYLPVGPSANGIAQARQVQGKELSYNNYNDADAALELVSEFRDGPPTVVIVKH
FT                   ANPCGVATGATLIEAYEAALACDSVSAFGGIIAVNRPLDGPTAEAISGIFTEVVAAPDA
FT                   DEDAKAIFAKKKNLRLLLTGDLPDPARPGLQIKSIAGGLLVQGRDNGRITRDQLKVVTK
FT                   RAPTEQELNDCLFAWTVAKHVKSNAIVYAKAGSTAGIGAGQMNRLESARIAAWKAKDAA
FT                   EKAGWAEARTLGSAVASDAFFPFADGLLAAVEAGATAVIQPGGSIRDEEVIAAADEAGL
FT                   AMVFTGMRHFRH"
     atgtcagacg tcaccatcaa gcgcgccctt ctttccgtgt cggacaagtc cggccttatc        60
     gagctgggcc aggcgctggg caggcatgga gtcgaactgg tgtcgaccgg cggcacggcc       120
     aaggcgctgc gcgaggcggg cctggccgtg aaggacattt ccgacctcac cggctttccc       180
     gaaatgatgg acggccgcgt caagacgctg catcccaagg tgcatggcgg cctgctcgcc       240
     gtgcgcggca atgcagagca tgtcgccgct atgcaggcgc atgacatcgg cgcgatcgac       300
     ctggtcgtcg tcaacctcta cccctttgcc gccacggttg cgaaaggggc ggatcgcgag       360
     gagatcatcg agaatatcga cattggcggc ccctccatgg tccgctccgc cgcgaagaac       420
     catgaaagcg tggcgatcgt caccgacccg gccgactatg cccggctggt cgcggagatg       480
     gaggagaagg gcggcgcgac cagctacgac ttccgccgca tgctcgcggc caaggcctat       540
     gccgccaccg ccgcctatga ttcgatgatc gcgagctggt tcgccttcgc cgaccagggc       600
     gcgcagttcc ccgaaagcct ctcggtctcc agcaggctgg gttcgaccct tcgctatggc       660
     gaaaaccccc atcagtcggc cgcgctctac ctgccggtcg gcccgtccgc caacggcatc       720
     gcccaggcgc ggcaggtcca gggcaaggaa ctcagctaca ataattacaa cgacgccgac       780
     gccgcgctgg aactggtcag cgaattccgc gacggcccgc cgaccgtcgt gatcgtcaag       840
     catgccaatc cctgcggcgt cgccaccggc gccacgctga tagaggccta tgaagccgcg       900
     ctcgcctgcg acagcgtttc ggcattcggc ggcatcatcg cggtcaaccg tccgctcgac       960
     ggcccgaccg ccgaagcgat cagcggcatc ttcaccgaag tcgtcgccgc cccggacgcg      1020
     gacgaggatg cgaaggcgat cttcgcgaag aagaagaacc tccgcctgct gttgaccggc      1080
     gacctgcccg atccggcgcg ccccggcctc cagatcaaga gcattgccgg cgggctgctg      1140
     gtgcagggtc gcgacaatgg gcggatcacc cgcgatcagt tgaaggtggt gacgaagcgc      1200
     gcgcctaccg agcaggaact gaacgattgc ctgttcgcct ggacagtcgc caagcacgtc      1260
     aagtccaacg ccatcgtcta tgccaaggcg ggcagcaccg cgggcatcgg cgcggggcag      1320
     atgaaccgcc tggaatccgc ccgcatcgcc gcgtggaagg cgaaggacgc cgctgaaaag      1380
     gcgggctggg cggaggcgcg cacactcggt tcggcggtcg cgtcggacgc cttcttcccc      1440
     tttgccgacg gcctgctggc ggcggtcgag gcgggcgcga cggcggtgat ccagcccggc      1500
     ggctccatcc gcgacgagga ggttatcgcc gccgccgacg aagccggcct ggcgatggtg      1560
     tttaccggca tgcgccactt ccgccattag                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page