(data stored in ACNUC7421 zone)

EMBL: AP010803.RIBD

AP010803.RIBD        Location/Qualifiers
FT   CDS_pept        307882..308835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SJA_C1-02910"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="bifunctional protein"
FT                   /note="pyrimidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95125"
FT                   /db_xref="GOA:D4YXP3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP3"
FT                   /protein_id="BAI95125.1"
FT                   /translation="MAAAIALSQRGRGLSTPNPNVGCLIVKDGHVVGRGWTQRGGRPHA
FT                   EAQALDEALDRARGATAYVTLEPCFHLSPRGPRCADRMARAGVRRVVIALRDPDPRTDG
FT                   QGAAWLRQHGVAVDMGLMAGEAAAAMRGFVLRQTLGRPAVTLKLGLSLDGRIALADGSS
FT                   RWITGPEARAHAHMERARHDAILVGGGTLRADAPRLDVRLLGLEDRSPRRVLLSHGDAP
FT                   GGWETIAAPEDIAALPQVDHLLVEGGAQAAAAFLRADLVDRLLLYRAPILIGAGLAGVG
FT                   DIGLTDLAGAHGRWRLDDERRLGNDRLEVYLRSRNA"
     atggccgccg ccatcgccct ctcgcaacgc ggacgcggcc tttccacgcc caaccccaat        60
     gtcggctgcc tgatcgtgaa ggacggccat gtcgtcgggc gcggctggac gcagaggggc       120
     ggccgccccc atgcggaggc gcaggcgctg gacgaggcgc tggaccgcgc ccgcggcgcc       180
     accgcctatg tgacgctgga gccatgcttc cacctttccc cgcgcggccc gcgctgcgcc       240
     gaccggatgg cccgcgccgg ggtgcggcgg gtggtgatcg ccctgcgcga tcccgatccg       300
     cgcactgacg ggcagggcgc cgcatggctg cgccagcacg gcgtcgccgt cgacatgggg       360
     ctgatggcgg gggaagccgc cgccgcgatg cgcggtttcg tgctgcgcca gaccctaggc       420
     cgcccggcgg tgacgctgaa gctcggcctg tcgctcgacg gccggatcgc gctggccgac       480
     ggcagcagcc gctggatcac cggccccgaa gcccgcgccc atgcccatat ggagcgggca       540
     cggcatgacg ccatattggt gggcggcggc acgctgcgcg ccgacgcgcc ccggctggac       600
     gtgcggctgc tggggctgga ggaccgctcg ccccggcgcg tgctgctcag ccatggcgac       660
     gcgcccggcg gctgggaaac catcgccgcg ccggaggata tcgccgccct gccgcaggtc       720
     gaccatctgc tggtggaggg cggcgcgcag gccgccgccg ccttcctgcg cgccgatctg       780
     gtcgaccggc tgctgctcta tcgcgccccg atcctgatcg gcgcggggct ggcgggcgtg       840
     ggcgacatcg gcctgaccga tctggccggg gcgcatggcc gctggcggct cgacgacgaa       900
     cggcggctgg gcaatgatcg gctggaggtt tacctgcgca gccggaacgc ctag             954
//

If you have problems or comments...

PBIL Back to PBIL home page