(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLB

AP010803.RPLB        Location/Qualifiers
FT   CDS_pept        645295..646131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SJA_C1-06300"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95464"
FT                   /db_xref="GOA:D4YYN2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN2"
FT                   /protein_id="BAI95464.1"
FT                   /translation="MALKSYNPTSPAQRGLILVDRSALHKGKPVKALTEGKRKTGGRNN
FT                   KGHVTSRGIAGGHKQRYRIIDFKRRLWDVEGTVERLEYDPNRTAFIALVNYPDGTQAYI
FT                   LAPQRLAPGDKVIAGKKTDVKPGNAMELGQMPVGTIIHNIEMKPGKGGQLCRSAGTYAQ
FT                   LVGRDRGMVMVRLSSGEQRYIRSDCMGTVGAVSNPDNANTNLAKAGRNRWLGKRPLTRG
FT                   VAKNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRHNKATDKFIIRSRHAKKKR"
     atggcgctta agagctacaa cccgacgagc ccggcccagc gcggcctgat cctcgtcgac        60
     cgcagcgcgc tgcacaaggg caagcccgtc aaggcgctga ccgaaggcaa gcgcaagacc       120
     ggcggccgca acaacaaggg ccatgtgacc tcgcgcggca tcgccggcgg ccacaagcag       180
     cgttaccgca tcatcgactt caagcgtcgc ctgtgggacg tcgagggcac ggtcgagcgt       240
     ctggaatatg accccaaccg caccgccttc atcgcgctgg tcaactatcc cgacggcacc       300
     caggcctata tcctggctcc ccagcgcctt gcgccgggcg acaaggtgat cgcgggcaag       360
     aagaccgacg tgaagccggg caacgcgatg gaactgggcc agatgccggt cggcaccatc       420
     atccacaata tcgagatgaa gccgggcaag ggcggtcagc tttgccgttc ggcgggcacc       480
     tatgcccagc tcgtcggccg cgatcgcggc atggtgatgg tccgcctgtc ctcgggcgag       540
     cagcgctaca tccgttcgga ctgcatgggc accgttggcg ccgtgtcgaa cccggacaac       600
     gccaacacca acctcgccaa ggccggccgc aaccgctggc tcggcaagcg tccgctgacg       660
     cgcggcgtgg cgaagaaccc ggtcgaccac ccgcatggcg gcggtgaagg ccggacctcg       720
     ggcggccgtc atccggtcac gccctggggc aagccgacca agggtgcgcg cacccgccac       780
     aacaaggcga cggacaagtt catcatccgt agccgccacg cgaagaagaa gaggtaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page