(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLC

AP010803.RPLC        Location/Qualifiers
FT   CDS_pept        643601..644356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SJA_C1-06270"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95461"
FT                   /db_xref="GOA:D4YYM9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM9"
FT                   /protein_id="BAI95461.1"
FT                   /translation="MRTGVIAKKVGMTRLFQEDGRHIPVTVLALEGNQVVARKEVERDG
FT                   YVAVQLGAGVAKVKNVAKPQRGHFAKAEVEPKARLVEFRVAEDALLDVGAEIAADHFIA
FT                   GQLVDVAGHTQGKGFAGAMKRWGFGGMRATHGVSISHRAHGSTGNRQDPGRVFKNKKMA
FT                   GHMGDRERTQQNLEIVRTDVERGLLFVKGSVPGAKGTWLTVCDAVKVKRPADAPYPASL
FT                   KQAANSNNAPAETPAEEAAAPEATEGQEG"
     atgcgcacag gcgtgatcgc taagaaagtc gggatgaccc gtctgttcca ggaggacgga        60
     cgtcatattc cggttacggt tctggccctt gagggcaatc aggtcgtggc ccgcaaggaa       120
     gtcgagcgtg acggttatgt cgcggttcag ctcggcgcgg gcgtcgcgaa ggtcaagaat       180
     gtcgccaagc cgcagcgcgg ccacttcgcc aaggcggaag tggagccgaa ggcgcgcctg       240
     gtcgaattcc gcgtcgccga ggatgcgctc ctcgatgtcg gcgccgagat cgcggccgat       300
     catttcatcg ccggccagct ggtcgacgtt gccggtcaca cccagggcaa gggtttcgcc       360
     ggcgccatga agcgctgggg cttcggcggc atgcgcgcca cccacggcgt gtcgatcagc       420
     caccgcgccc atggttcgac gggtaaccgc caggatccgg gccgcgtctt caagaacaag       480
     aagatggccg gtcacatggg cgaccgcgag cggacccagc agaacctgga aatcgtccgc       540
     acggacgtcg agcgcggcct gctgttcgtc aagggcagcg tcccgggcgc caagggcacc       600
     tggctgaccg tctgcgacgc cgtcaaggtg aagcgtccgg cggacgcgcc ctatccggcc       660
     agcctgaagc aggctgccaa cagcaacaac gctccggctg aaacgcccgc tgaagaagcg       720
     gccgcgcccg aagcgaccga aggccaggag ggctaa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page