(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLF

AP010803.RPLF        Location/Qualifiers
FT   CDS_pept        650614..651147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SJA_C1-06420"
FT                   /product="ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95476"
FT                   /db_xref="GOA:D4YYP4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP4"
FT                   /protein_id="BAI95476.1"
FT                   /translation="MSRTGKKPVAVPAGVTAAIADGQLSVKGPKGTLSLPLADEVTYSI
FT                   EEGSIAVKPANDSKRARAFWGMQRTLIANLITGVTEGFSKKLLITGVGYRANAQGKTLK
FT                   LQLGYSHDVDFAVPEGIEIKTPDNTTVEISGIDKQKVGQVAAEIRRWRKPEPYKGKGIK
FT                   YAGEFIFRKEGKKK"
     atgagccgta ctggtaagaa gccggttgcc gtccccgcgg gcgtcaccgc cgccatcgcc        60
     gacggtcagc tttcggtgaa ggggcccaag ggcaccctgt cgctgccgct ggccgacgaa       120
     gtgacctaca gcatcgagga aggctcgatc gccgtgaagc ctgccaatga cagcaagcgc       180
     gcccgcgctt tctggggcat gcagcgcacg ctgatcgcga acctgatcac cggcgtgacc       240
     gagggctttt cgaagaagct gctcatcacc ggcgtcggtt accgcgccaa cgcccagggc       300
     aagaccctga agctgcagct cggctattcg cacgacgtcg atttcgcggt gccggaaggc       360
     atcgagatca agaccccgga caacaccacg gtcgagatca gcggcatcga caagcagaag       420
     gtgggtcagg ttgccgccga gatccgccgc tggcgcaagc ccgaacccta taagggcaag       480
     ggtatcaagt acgctggcga gttcatcttc cgcaaggaag ggaagaagaa gtaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page