(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLM

AP010803.RPLM        Location/Qualifiers
FT   CDS_pept        615899..616378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SJA_C1-06030"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95437"
FT                   /db_xref="GOA:D4YYK5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK5"
FT                   /protein_id="BAI95437.1"
FT                   /translation="MKALMKTTKPATPATVEKKWVLIDAEGLVVGRLASTVANILRGKH
FT                   KPSFTPHVDCGDNVIIINAEKVKFTGRKLTDKVYYKHTGYAGGIKETTPQKVLEGRFPE
FT                   RVLEKAVERMIPRGPLGRQQMRNLRIFAGAEHPHAAQNPEVLDFASRNRKNKVGA"
     atgaaggcgc tgatgaagac caccaagccg gcaaccccgg ccacggtcga aaagaaatgg        60
     gttctgatcg acgcggaagg cctcgtcgtc ggccgcctcg cctcgaccgt cgcgaacatc       120
     ctgcgcggca agcacaagcc gagcttcacc ccccatgtcg attgcggtga caatgtcatc       180
     atcatcaacg cggaaaaggt gaagttcacc ggccgcaagc tgaccgacaa ggtctattac       240
     aagcacaccg gctatgccgg cggcatcaag gaaaccaccc cccagaaggt tctggaaggc       300
     cgtttccccg agcgcgtcct ggaaaaggcc gtcgagcgca tgatcccccg cggtccgctg       360
     ggccgccagc agatgcgcaa cctgcgcatc ttcgccggcg ccgaacaccc gcacgccgcg       420
     cagaaccccg aagtgctcga cttcgcgtcg cgcaaccgca agaacaaggt gggtgcataa       480
//

If you have problems or comments...

PBIL Back to PBIL home page