(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLN

AP010803.RPLN        Location/Qualifiers
FT   CDS_pept        648599..648967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SJA_C1-06370"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95471"
FT                   /db_xref="GOA:D4YYN9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN9"
FT                   /protein_id="BAI95471.1"
FT                   /translation="MIQMQSNLDVADNSGAKRVQCIKVLGGSKRRFASVGDIIVVSIKE
FT                   AAPRGKVKKGDVHRAVIVRTAKDVRRADGSVIRFDGNAAVLINKNEEPIGTRIFGPVVR
FT                   ELRAKKHMKIISLAPEVL"
     atgatccaga tgcaatccaa tcttgacgtc gctgacaaca gcggcgccaa gcgcgtccag        60
     tgcatcaagg tgctgggcgg atcgaagcgt cgcttcgcga gcgtgggcga catcatcgtc       120
     gtctcgatca aggaagccgc gcctcgtggc aaggtgaaga agggtgacgt gcaccgcgcc       180
     gtcatcgtgc gcaccgccaa ggacgtgcgt cgcgctgacg gcagcgtgat tcgcttcgac       240
     ggcaatgccg ccgtgctgat caacaagaac gaggagccga tcggcacccg tatctttggc       300
     ccggtcgttc gcgaactgcg cgccaagaag cacatgaaga tcatctcgct cgcccctgag       360
     gtgctgtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page