(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLO

AP010803.RPLO        Location/Qualifiers
FT   CDS_pept        652550..653086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SJA_C1-06460"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95480"
FT                   /db_xref="GOA:D4YYP8"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP8"
FT                   /protein_id="BAI95480.1"
FT                   /translation="MTKLNELNDNAGARKGRMRVGRGIGSGKGKTAGRGQKGAKARSGV
FT                   SINGFEGGQMPLHMRLPKRGFNNIFAKDFAIVNLGAVQKAIDAGKLDANATIDHAALKA
FT                   AALARGGKDGVRLLAKGDLTAKVSFLVAGASKGAVEAVEKAGGKVDVIAVVPAAEKAKA
FT                   KKGTALAAKKAAAKA"
     atgaccaagc ttaacgaact caatgacaat gccggcgccc gcaagggccg gatgcgcgtg        60
     ggccgtggta tcggttccgg caagggcaag accgccggtc gcggccagaa gggcgcgaag       120
     gcgcgttcgg gcgtcagcat caacggcttc gagggtggcc agatgccgct ccacatgcgt       180
     ctgccgaagc gtggcttcaa caatatcttc gccaaggatt tcgcgatcgt gaacctgggc       240
     gcggtgcaga aggcgatcga cgccggcaag ctggacgcca acgcgaccat cgatcatgcg       300
     gcgctgaagg ccgctgccct cgcccgtggc ggcaaggacg gcgtgcgcct gctcgccaag       360
     ggcgatctga ccgccaaggt cagcttcctg gtcgccggcg cgtcgaaggg cgcggtcgaa       420
     gcggtagaga aggccggcgg caaggtcgat gtgatcgctg tcgttcccgc ggctgaaaag       480
     gccaaggcga agaagggcac cgcccttgcc gcgaagaagg ccgctgcaaa ggcctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page