(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLP

AP010803.RPLP        Location/Qualifiers
FT   CDS_pept        647520..647951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SJA_C1-06340"
FT                   /product="ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95468"
FT                   /db_xref="GOA:D4YYN6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN6"
FT                   /protein_id="BAI95468.1"
FT                   /translation="MLQPKKMKFRKTFKGRIKGDAKGGSALNFGAYGLKALEPERVTAR
FT                   QIEAARRAIQRHLRRQGRLWIRVFPDVPVSKKPAEVRQGKGKGSVEYWAARVKPGRILF
FT                   ELDGVPGPLAAEAFSRAAMKLPIKTKVVARLGDTSHLEG"
     atgctgcaac cgaaaaaaat gaagttccgc aagaccttca agggccggat caagggcgac        60
     gccaagggcg gttctgctct gaacttcggc gcctatggtc tgaaggccct ggagcccgag       120
     cgcgtcaccg cgcgccagat cgaggcggcc cgccgcgcga tccagcgcca cctgcgccgt       180
     cagggccgcc tgtggatccg cgtgttcccc gacgtgccgg tttccaagaa gcccgccgaa       240
     gtccgtcagg gcaagggcaa gggttcggtc gaatattggg cagcccgcgt caagccgggc       300
     cgcatcctgt tcgaactgga cggcgtgccc ggcccgctcg cagcagaggc tttctcgcgc       360
     gccgcgatga agctgccgat caagacgaag gttgtcgctc gcctcggcga cacctcccac       420
     ctggagggct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page