(data stored in SCRATCH zone)

EMBL: AP010803.RPLQ

AP010803.RPLQ        Location/Qualifiers
FT   CDS_pept        complement(589695..590120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SJA_C1-05780"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95412"
FT                   /db_xref="GOA:D4YYI0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI0"
FT                   /protein_id="BAI95412.1"
FT                   /translation="MRHKVGHRKLQRSAGHRNSLLRNLAASLIKHEQILTTTPKAKELR
FT                   PYVEKLITLAKKGGLSNRRLAHARLQDDAQLTKLFDVLAERYKDRNGGYTRVIKAGIRA
FT                   SDAAPIAIIELVDRDVDAKGQDSGPVQNADADELEAA"
     atgcgtcaca aggttggtca tcgcaagctg cagcgcagcg ccgggcatcg caactcgctg        60
     ctccgcaacc tcgcggcttc gctcatcaag catgagcaga tcctgacgac cacgcccaag       120
     gcgaaggaac tgcgtcccta tgtcgagaag ctgatcaccc tcgccaagaa gggtggcctg       180
     tcgaaccgtc gcctggccca tgcgcgcctg caggacgacg cgcagctcac caagctgttc       240
     gacgttctgg ccgagcgcta caaggatcgc aacggcggct atacccgcgt gatcaaggcc       300
     ggcatccgcg cttcggacgc ggcgccgatc gcgatcatcg aactggtcga ccgcgacgtc       360
     gatgccaagg gtcaggattc cggtccggtc cagaacgccg acgccgacga actggaagcg       420
     gcatga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page