(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLR

AP010803.RPLR        Location/Qualifiers
FT   CDS_pept        651149..651502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SJA_C1-06430"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95477"
FT                   /db_xref="GOA:D4YYP5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP5"
FT                   /protein_id="BAI95477.1"
FT                   /translation="MAKLSLFARRRRRVRTALKAVSGTRPRLSVHRSGRHIYAQVIDDA
FT                   QGKTLAAASTLDKDVRGKTGATADAAADVGKRVAAAATAAGVTQVVFDRGGFLFHGRVK
FT                   ALADAAREAGLEF"
     atggcaaagc tttccctctt cgcgcggcgc cgtcgccgcg tccgcaccgc gctcaaggct        60
     gtttcgggca cgcgtccgcg cctcagcgtc caccgttcgg gccgtcacat ctacgcccag       120
     gtcatcgacg acgcgcaggg caagaccctg gcggccgcgt cgaccctgga caaggatgtg       180
     cgcggcaaga ccggcgccac cgccgacgcc gccgccgatg tcggcaagcg cgtcgccgcc       240
     gcggcgaccg ccgccggcgt cacccaggtc gtgttcgacc gtggtggctt cctgttccat       300
     ggccgcgtca aggcgctggc cgatgcggcc cgtgaagccg ggctggagtt ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page