(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLV

AP010803.RPLV        Location/Qualifiers
FT   CDS_pept        646415..646798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SJA_C1-06320"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95466"
FT                   /db_xref="GOA:D4YYN4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN4"
FT                   /protein_id="BAI95466.1"
FT                   /translation="MSKEKAPRRVADNEALAVGTQIRGSAQKLNLVATLIRGRKVEDAL
FT                   NILAFSKKAMAVDVRKVLASAIANAENNHNLDVDSLVVAEASVGKSFTMKRFHARGRGK
FT                   STRILKPFSRVRIVVREQAEAEA"
     atgagcaagg aaaaggctcc ccgccgcgtc gcggacaatg aggcgctggc cgtcggcacg        60
     cagatccgcg gttcggccca gaagctgaac ctggtcgcca cgctgatccg cggccgcaag       120
     gtcgaggacg cgctgaacat cctcgccttc tcgaagaagg cgatggccgt cgacgtgcgc       180
     aaggtgctgg cctcggccat tgccaatgcg gaaaacaacc acaatctgga cgtcgactcg       240
     ctggtcgtcg cggaagcatc ggtgggcaag agcttcacca tgaagcgctt tcacgctcgc       300
     ggccgcggca agtcgacccg gattctcaag cccttcagcc gcgtgcgcat cgtcgtgcgc       360
     gagcaggccg aagcggaggc gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page