(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLW

AP010803.RPLW        Location/Qualifiers
FT   CDS_pept        644975..645292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SJA_C1-06290"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95463"
FT                   /db_xref="GOA:D4YYN1"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN1"
FT                   /protein_id="BAI95463.1"
FT                   /translation="MAKKEATTVDNRHYDVVVAPVITEKSTLLSENNAVVFKVANDASK
FT                   PEIKAAVEAIWGVTVKSVNTLVAKGKTKRWKGKPYTRSDVKKAIVRLADGQSIDITEGV
FT                   R"
     atggctaaga aggaagcgac caccgtcgac aaccgtcatt atgacgtcgt cgtcgcgccg        60
     gtcatcaccg agaagtcgac ccttctctcc gagaacaacg ccgtggtctt caaggtcgcc       120
     aatgatgcgt cgaagccgga gatcaaggcc gccgtcgaag ccatttgggg cgtgaccgtc       180
     aagagcgtga acacgctggt cgccaagggc aagacgaagc gctggaaggg caagccctac       240
     acgcgctcgg acgtgaagaa ggcgatcgtt cgcctggccg acggccagtc gatcgacatc       300
     accgaaggag tgcgctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page