(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLX

AP010803.RPLX        Location/Qualifiers
FT   CDS_pept        648967..649278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SJA_C1-06380"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95472"
FT                   /db_xref="GOA:D4YYP0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP0"
FT                   /protein_id="BAI95472.1"
FT                   /translation="MSAAKIKKGDKVVILAGKDKGRTGAVLQVLPKDDKVLVEGINVHA
FT                   RHRKPDQANPQGGIERKPAPLHISNVAVADKDGKPTRVRFEDRDGKKVRVAVKSGEVL"
     atgagcgctg ccaagatcaa gaagggcgac aaggtcgtca tcctggccgg caaggacaag        60
     ggccgcaccg gcgccgtcct gcaggtgctg ccgaaggacg acaaggtcct ggtggaaggc       120
     atcaacgtgc atgcgcgcca tcgcaagccg gaccaggcga acccgcaggg cggcatcgag       180
     cgcaagcccg cgccgctcca catttcgaac gtcgctgtcg ccgacaagga tggcaagccg       240
     acccgcgtcc gtttcgagga ccgcgacggc aagaaggtcc gcgtcgccgt caagtccggt       300
     gaggtgctgt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page