(data stored in ACNUC7421 zone)

EMBL: AP010803.RPMD

AP010803.RPMD        Location/Qualifiers
FT   CDS_pept        652220..652396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SJA_C1-06450"
FT                   /product="ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95479"
FT                   /db_xref="GOA:D4YYP7"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP7"
FT                   /protein_id="BAI95479.1"
FT                   /translation="MAKIKIKQIGSPIRRPEAQKKILIGLGLGKMHRVVELEDTAEVRG
FT                   AIKKLPHMVEVVD"
     atggcgaaga tcaagatcaa gcagatcggt tcgccgatcc gtcgtcccga agcccagaag        60
     aagattctga tcggcctggg ccttggcaag atgcaccgcg tggtggaact ggaagatacc       120
     gcggaagtcc gcggcgcgat caagaagctc ccccatatgg tggaagtggt cgactaa          177
//

If you have problems or comments...

PBIL Back to PBIL home page