(data stored in ACNUC7421 zone)

EMBL: AP010803.RPMG

AP010803.RPMG        Location/Qualifiers
FT   CDS_pept        complement(103310..103477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="SJA_C1-01020"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94936"
FT                   /db_xref="GOA:D4YX54"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX54"
FT                   /protein_id="BAI94936.1"
FT                   /translation="MAKPATVKIRLVSSADTGFFYVTKKNPRTKTEKLSFRKYDPVVRK
FT                   HVEFKEAKIK"
     atggccaagc cagcaaccgt caagattcgc ctcgtcagct cggctgacac cggcttcttc        60
     tacgtcacca agaagaatcc gcgcaccaag accgagaagc tgagcttccg gaaatatgat       120
     cccgtcgtgc gcaagcatgt cgagttcaag gaagccaaga tcaagtga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page