(data stored in ACNUC7421 zone)

EMBL: AP010803.RPOA

AP010803.RPOA        Location/Qualifiers
FT   CDS_pept        complement(590298..591362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SJA_C1-05790"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95413"
FT                   /db_xref="GOA:D4YYI1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI1"
FT                   /protein_id="BAI95413.1"
FT                   /translation="MTVNMKNWQELKKPNSLEIKVAGDGRRKATFVAEPLERGFGLTLG
FT                   NALRRVLLSSLQGAAVTSIKIENVLHEFSSLAGVREDVTDIVLNIKQVALRMEGDGPRR
FT                   LQLSATGPAEVRAGDITTVGDIEVMNPDLVICHLDQGATLNMELTADVGKGYVPAVANR
FT                   PADAPIGLIPIDALYSPVRQVAYKVDNTRVGQELDYDKLSLTVETDGTVTPEDAVAYAA
FT                   RILQDQLQLFVHFEDALPAAAPAAGAAAGGSASEGESDANQINRYLLKKVDELELSVRS
FT                   ANCLKNDNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLSSMGLRLGMDIPGWPPEN
FT                   IEEMAKKLEQELLG"
     atgactgtca acatgaagaa ctggcaggaa ttgaagaagc ccaacagcct tgaaatcaag        60
     gtcgcgggcg acggcaggcg caaggcgacc ttcgtcgccg aacctctgga gcgcggcttc       120
     ggcctgacgc tcggcaatgc gctgcgccgg gttcttctgt cctcgctcca gggcgcggcg       180
     gtcacctcga tcaagatcga gaacgtcctg cacgaattct cctcgctcgc aggcgtgcgc       240
     gaagatgtga cggacatcgt cctcaacatc aagcaggtcg cgctcaggat ggaaggcgac       300
     ggtccgcgcc gtctccagct ttccgccacc ggccccgcag aggtgcgcgc gggcgacatc       360
     accaccgtgg gcgacatcga agtgatgaac cccgacctgg tgatctgcca cctggaccag       420
     ggcgcgacgc tgaacatgga actgaccgcc gacgtcggca agggctatgt ccccgccgtc       480
     gccaaccgtc cggccgacgc cccgatcggc ctgatcccga tcgacgcgct ctattcgccg       540
     gtgcggcagg tcgcctacaa ggtcgacaat acccgcgtcg gccaggaact ggactatgac       600
     aagctgtcgc tgaccgtcga gaccgacggc accgtcacgc cggaagacgc ggtggcctat       660
     gccgcccgca tcctgcagga ccagcttcag ttgttcgtcc acttcgagga cgcgctgccc       720
     gccgccgctc cggctgccgg cgccgccgcc ggcggttcgg ccagcgaggg cgagagcgac       780
     gcgaaccaga tcaaccgcta cctgctcaag aaggtggacg aactggaact gtcggtccgc       840
     agcgccaact gcctcaagaa cgacaacatc atctatatcg gcgacctggt ccagaagacc       900
     gaggccgaga tgctgcgcac ccccaatttc ggccgcaagt cgctgaacga aatcaaggaa       960
     gtgctgtcgt ccatggggct gcgcctgggc atggacatcc ccggctggcc gccggagaat      1020
     atcgaggaaa tggccaagaa gctcgaacag gagctgctgg gttaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page