(data stored in SCRATCH zone)

EMBL: AP010803.RPOE

AP010803.RPOE        Location/Qualifiers
FT   CDS_pept        493949..494515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SJA_C1-04890"
FT                   /product="ECF-type sigma factor"
FT                   /note="RNA polymerase sigma-70 factor, ECF subfamily /
FT                   DNA-directed RNA polymerase specialized sigma subunit,
FT                   sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95323"
FT                   /db_xref="GOA:D4YY91"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY91"
FT                   /protein_id="BAI95323.1"
FT                   /translation="MTASLPDCSDGELAALALGGRQAAYGELVRRHQGWVHRLVRSHVG
FT                   SMDEALDVTQASFVAAFAALNRYDVTRPFQVWMSRIVINKCHDWRRRRAVRNFFSMALP
FT                   LGEADDVADEAPLPDQAIGAEQQLAEAMKAIAALPASLKDTLILRTIDEKSEAETAEIL
FT                   GISQKAVETRLYRARARLAEMLKKV"
     atgaccgcga gcctccccga ctgctcggac ggggagcttg cggctttggc gcttggcggg        60
     cggcaagcgg cttatggcga actggtccgg cggcatcaag gttgggttca ccggctcgtg       120
     cgcagccatg tcggatctat ggatgaggcc ttagatgtca cccaggcgag cttcgtcgcg       180
     gcctttgccg cactcaaccg ctatgacgta acccgaccct tccaggtctg gatgtcccgg       240
     atcgtcatca acaaatgcca tgactggcgg cgccggcgcg cggtccgaaa cttcttctcc       300
     atggccctgc cgctgggcga ggcggatgac gtcgccgatg aggcgccgct acccgaccag       360
     gcaatcggcg ccgagcagca gctggcagag gcgatgaagg cgatcgccgc cctgcccgcc       420
     tctctcaagg acacgctcat cctgcggacg atcgacgaga aatcggaagc cgaaaccgcc       480
     gagattctcg gcatcagcca gaaggcagtc gagactcgcc tctaccgcgc ccgcgcacgc       540
     ctcgcagaaa tgttgaagaa agtttga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page