(data stored in ACNUC7421 zone)

EMBL: AP010803.RPON

AP010803.RPON        Location/Qualifiers
FT   CDS_pept        3824..4420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="SJA_C1-00060"
FT                   /product="sigma 54"
FT                   /note="ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94840"
FT                   /db_xref="GOA:D4YWV8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV8"
FT                   /protein_id="BAI94840.1"
FT                   /translation="MDIRVSGHQVDTGDALKQHVWTRLEAMAEKYFSRALSAQVTFRPA
FT                   PHGAFHCDIVCHVMTGLILKGAGEAQEAHPAFDQAAERIEKQLRRYLRRLKDRSAQAAA
FT                   AEANRANGFSVEELDGAGYTIFASPADEEEPAEAPLIVAETKVDIPEASVSDAVMMLDL
FT                   RNTNALLFVNAGTAAYNMVYRRQDGTIGWVEPRLA"
     atggatattc gtgtttccgg gcatcaggtc gatacgggcg acgcgctcaa gcagcatgtc        60
     tggacccgtc tggaggccat ggccgagaaa tatttttccc gcgcgctttc cgcccaggtc       120
     acgttccggc cggccccgca cggcgccttc cattgcgaca tcgtctgcca tgtcatgacc       180
     ggcctgatcc tcaagggcgc cggagaggcg caggaggcgc atcccgcctt cgatcaggcg       240
     gccgagcgga tcgagaagca gttgcgccgc tacctccgcc gcctgaagga ccgcagcgcc       300
     caggccgccg cggccgaggc gaaccgggcc aatggtttca gcgttgagga gcttgacggc       360
     gcaggctaca cgattttcgc atccccggcc gatgaggagg aaccggccga agcgccgctg       420
     atcgtggcgg aaaccaaggt cgacattccc gaagccagcg tgtcggatgc ggtgatgatg       480
     ctcgacctgc gcaacaccaa cgcgctgttg ttcgtcaatg ccgggaccgc ggcgtacaac       540
     atggtctatc gccggcagga cgggaccatc ggctgggtcg agccccgcct ggcctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page