(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSC

AP010803.RPSC        Location/Qualifiers
FT   CDS_pept        646803..647498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SJA_C1-06330"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95467"
FT                   /db_xref="GOA:D4YYN5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN5"
FT                   /protein_id="BAI95467.1"
FT                   /translation="MGHKSNPIGLRLQINRTWDSRWFAEGADYGRLLLEDLKIRQFIMK
FT                   NLPQAAISKVVIERPAKLCRVSIYAARPGVIIGKKGADIEKLRKKLGGLTSSDVSLNIV
FT                   EIRKPEIDSKLVAQGIADQLERRVAFRRAMKRAVQSALRLGAEGIKITCGGRLGGAEIA
FT                   RVEWYREGRVPLHTLRANVDYAEAEAHTAYGVCGIKVWIFKGEILGHDPMATDRLMLEA
FT                   QTSGVRPAR"
     atgggtcaca agagcaatcc gatcggtctg cgtctgcaga tcaaccgtac ctgggacagc        60
     cgctggttcg cggaaggcgc cgactatggc cgcctgctgc tggaggatct gaagatccgc       120
     cagtttatca tgaagaacct gccgcaggcc gcgatctcca aggtcgtgat cgagcgtccg       180
     gccaagctgt gccgcgtgtc gatctacgcc gcccgtcccg gtgtcatcat cggcaagaag       240
     ggcgcggaca tcgaaaagct gcgcaagaag ctgggcggct tgacctcttc ggacgtcagc       300
     ctgaacatcg tcgaaatccg caagccggaa atcgactcca agctcgtcgc gcagggcatc       360
     gccgaccagt tggagcgccg cgtggcgttc cgccgcgcca tgaagcgcgc ggtgcagagc       420
     gccctgcgtc tcggcgccga aggcatcaag atcacctgcg gcggccgtct gggcggcgcg       480
     gagatcgccc gcgtggaatg gtatcgcgaa ggccgcgttc cgctgcacac gctgcgcgcg       540
     aacgtcgact atgccgaagc cgaagcccac accgcttatg gcgtttgcgg catcaaggtc       600
     tggatcttca agggtgagat tctgggccac gatccgatgg ccaccgaccg gctgatgctg       660
     gaggctcaga cctccggcgt gcgcccggcg cgctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page