(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSE

AP010803.RPSE        Location/Qualifiers
FT   CDS_pept        651506..652213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SJA_C1-06440"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95478"
FT                   /db_xref="GOA:D4YYP6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP6"
FT                   /protein_id="BAI95478.1"
FT                   /translation="MADENEIQAQPGAPAAVEGGEQTEGRRGRGRGGDRNRGERGGRGR
FT                   RDDRRGNRDEEQGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAR
FT                   EVPEAISKATASAKKAMVRVPLKEGRTLHHDGLGHFGAGKVTVRSAPAGTGIIAGGPMR
FT                   AVFESLGVADVVTKSNGTSNPYNMIRATFAALGEQTSPKSVAQRRGKKVADLLRRGGAS
FT                   AEVAQADAEAIAE"
     atggctgacg aaaacgaaat ccaggcccag ccgggcgcac cggctgccgt tgaaggcggc        60
     gagcagaccg aaggccgtcg cggccgtggt cgcggcggcg accgcaaccg tggcgagcgt       120
     ggcggccgtg gccgtcgcga cgaccgtcgc ggcaatcgtg acgaggaaca gggcgaggaa       180
     ctgatcgaga agctggttca catcaaccgc gtctcgaaga ccgtcaaggg cggcaagcgc       240
     ttcggcttcg ctgctctggt cgtcgtcggc gacggcaagg gccgcgcggg cttcggccat       300
     ggcaaggcgc gcgaagtgcc cgaagccatc agcaaggcga ccgcttcggc caagaaggcg       360
     atggtccgcg ttccgctgaa ggaaggccgc acgctgcacc atgatggcct gggccatttc       420
     ggcgcaggca aggtgacggt tcgttcggcc ccggccggta cgggcatcat cgccggtggt       480
     ccgatgcgcg ccgtgttcga aagcctcggc gtcgctgacg tcgtgaccaa gtcgaacggc       540
     acgtcgaacc cctataacat gatccgcgcg accttcgcgg cgctgggcga gcagaccagc       600
     cccaagtcgg tggcgcagcg tcgcggcaag aaggtcgccg accttctgcg tcgcggcggc       660
     gcctcggccg aagtcgcgca ggccgatgcc gaagcgattg cggagtaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page