(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSG

AP010803.RPSG        Location/Qualifiers
FT   CDS_pept        638721..639191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SJA_C1-06230"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95457"
FT                   /db_xref="GOA:D4YYM5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM5"
FT                   /protein_id="BAI95457.1"
FT                   /translation="MSRRRRPEKRVILPDPKFGDVVLSKFMNSIMQDGKKAVAESIVYG
FT                   ALDTVEAKSKKDPIAMFHDALNNVKPGIEVRSRRVGGATYQVPVEVRPERAQALAIRWL
FT                   ITASRNRSETTMAARLSGELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW"
     atgtcacgtc gtcgtcgccc cgaaaagcgc gtcatcctgc ccgatcccaa gttcggtgat        60
     gtcgtgctgt cgaagttcat gaacagcatc atgcaggacg gcaagaaggc cgtcgccgag       120
     tccatcgtgt acggcgctct cgacactgtc gaggcgaagt ccaagaagga cccgatcgcc       180
     atgttccatg acgcgctgaa caatgtgaag cccggcatcg aggtccgcag ccgccgcgtc       240
     ggcggtgcga cctaccaggt ccccgtcgaa gtgcgcccgg agcgcgccca ggcgctggcg       300
     atccgctggc tgatcaccgc gtcgcgcaac cgcagcgaaa ccaccatggc tgcccgcctg       360
     tcgggcgagc tgctggacgc cgccaacaat cgcggcaatg cggtcaagaa gcgcgaagac       420
     acgcaccgca tggcggaagc gaaccgcgcc ttctcgcatt atcgctggta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page