(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSH

AP010803.RPSH        Location/Qualifiers
FT   CDS_pept        650219..650614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SJA_C1-06410"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95475"
FT                   /db_xref="GOA:D4YYP3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP3"
FT                   /protein_id="BAI95475.1"
FT                   /translation="MALTDPLGDMLTRIRNGQQAKKDSVVSPASKLRARVLDVLQREGY
FT                   IRGYSEELLGNHPGLRIELKYFEGQPAIKHVARVSKPGRRVYSGSKELPVIRNGLGITI
FT                   VSTPRGVLSDAEAREQNVGGEVLAEVF"
     atggcattga ccgatcccct gggtgatatg ctcacccgca tccgcaacgg gcagcaggcg        60
     aagaaggaca gcgtcgtgtc ccccgcttcg aagctgcgcg cccgcgtgct cgacgtgctg       120
     cagcgcgaag gctatatccg tggctattcc gaggaactgc tcggcaacca tcccggcctg       180
     cgcatcgagc tcaaatattt cgaaggccag ccggcgatca agcatgtcgc ccgcgtgtcc       240
     aagccgggcc gccgcgttta ctccggttcc aaggaactgc cggtgatccg caacggcctg       300
     ggcatcacca ttgtctcgac gccccgcggc gttctgtccg acgccgaagc gcgcgagcag       360
     aatgtcggcg gcgaagtgct ggcggaggtg ttctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page