(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSI

AP010803.RPSI        Location/Qualifiers
FT   CDS_pept        616378..616905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SJA_C1-06040"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95438"
FT                   /db_xref="GOA:D4YYK6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK6"
FT                   /protein_id="BAI95438.1"
FT                   /translation="MSDNRQSLSDLASLTANAPAPAAAPAADAPIAPAQPAAPLRAQEI
FT                   DSLGRAYATGRRKDAVARVWVKPGTGKITVNGRDQEIYFARPTLRLVINQPFGVTEREG
FT                   QYDVIATVKGGGLSGQAGAVKHGIAQALAKYEPALRSAVKAEGFLTRDSRAVERKKYGK
FT                   AKARRSFQFSKR"
     atgtccgata accgccagtc cctgtccgac ctcgcgtcgc tgaccgccaa cgcgccggct        60
     cctgccgccg cgcccgccgc cgacgctccg atcgcgccgg ctcagcccgc cgctccgctg       120
     cgcgcccagg aaatcgacag cctcggccgc gcctatgcga ccggccgccg caaggatgcc       180
     gtcgcccgcg tctgggtgaa gcccggcacc ggcaagatca cggtcaacgg ccgcgaccag       240
     gaaatctact tcgcccgccc gaccctgcgc ctggtgatca accagccctt cggcgtcacc       300
     gagcgcgaag gccagtatga cgtgatcgcc accgtcaagg gcggcggcct gtccggccag       360
     gccggcgcgg tcaagcacgg catcgcccag gcgctcgcca agtacgagcc ggcgctgcgc       420
     agcgcggtca aggccgaagg cttcctgacc cgcgacagcc gcgccgtcga gcgcaagaag       480
     tacggcaagg ccaaggcccg ccgcagcttc cagttctcga agcgctaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page