(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSJ

AP010803.RPSJ        Location/Qualifiers
FT   CDS_pept        642975..643283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SJA_C1-06260"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95460"
FT                   /db_xref="GOA:D4YYM8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM8"
FT                   /protein_id="BAI95460.1"
FT                   /translation="MDSNIRIRLKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTRI
FT                   EKFTVNRGPHIDKKSREQFEVRTYKRMLDIVQPTPQTVDALMKLDLAAGVNVEIKLA"
     atggacagca acatccgcat tcgcctcaag gcgttcgatc atcgcgtgct cgatcaggcg        60
     accggcgaca tcgccgacac cgcccgccgc accggcgccc ttatccgcgg tccgattccc       120
     cttccgacgc gcatcgaaaa gttcacggtc aaccgtggcc cgcacatcga caagaagtcg       180
     cgcgagcagt tcgaggtccg cacctacaag cgcatgcttg acattgtgca gccgacgccg       240
     cagacggtcg acgcgctgat gaagctggac ctggctgccg gcgtgaacgt ggaaatcaaa       300
     ctcgcttaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page