(data stored in SCRATCH zone)

EMBL: AP010803.RPSK

AP010803.RPSK        Location/Qualifiers
FT   CDS_pept        complement(591484..591873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SJA_C1-05800"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95414"
FT                   /db_xref="GOA:D4YYI2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI2"
FT                   /protein_id="BAI95414.1"
FT                   /translation="MAREPQRIKRRERKNISAGVAHVNASFNNTMVTITDAQGNAISWS
FT                   SAGMMGFKGSRKSTPYAAQVCAEDAGRKAAEHGVRTLEVEVKGPGSGRESALRALQAVG
FT                   FHITSIRDVTPIPHNGVRPSKRRRV"
     atggcacgcg aaccccagcg catcaagcgc cgcgaacgca agaacatctc ggccggcgtc        60
     gcgcacgtca acgccagctt caacaacacc atggtgacca tcaccgacgc ccagggcaac       120
     gcgatctcct ggtcctcggc gggcatgatg ggcttcaaag gcagccgcaa gtcgaccccc       180
     tatgccgcgc aggtctgcgc cgaggacgcc ggtcgcaagg ccgccgaaca tggcgtgcgc       240
     acgctggaag tcgaagtgaa gggtccgggt tcgggccgcg aatcggccct gcgcgccttg       300
     caggccgtcg gcttccacat cacctccatc cgcgacgtga cgccgatccc gcacaatggc       360
     gtgcgtcctt ccaagcgccg ccgcgtctaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page