(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSL

AP010803.RPSL        Location/Qualifiers
FT   CDS_pept        638334..638705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SJA_C1-06220"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95456"
FT                   /db_xref="GOA:D4YYM4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM4"
FT                   /protein_id="BAI95456.1"
FT                   /translation="MPTINQLVRKGRELQKTKSKVPAMEANPQKRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLVNQREVITYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDT
FT                   QGVKDRKQSRSKYGAKRPK"
     atgccaacga tcaaccagct ggtccgcaag ggccgcgagc tgcagaagac caagtcgaag        60
     gttcctgcaa tggaagcgaa cccgcagaag cgcggcgttt gcacccgtgt ctacacgacg       120
     actccgaaga agccgaactc ggccctccgc aaggtggcga aggtgcgtct ggtcaaccag       180
     cgcgaagtca tcacctacat tccgggtgaa ggccacaacc ttcaggagca cagcgtcgtg       240
     ctgatccgcg gcggccgcgt gcgcgacctt cccggtgtgc gctatcacgt gctgcgcggc       300
     gttctggata cccagggcgt caaggaccgc aagcagagcc gttcgaagta cggcgccaag       360
     cgtccgaagt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page