(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSM

AP010803.RPSM        Location/Qualifiers
FT   CDS_pept        complement(591975..592343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SJA_C1-05810"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95415"
FT                   /db_xref="GOA:D4YYI3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI3"
FT                   /protein_id="BAI95415.1"
FT                   /translation="MARIAGVNIPTNKRVIIALTYIHGIGRKTAVDIADKLGIDHSRRV
FT                   QDLSDAEVLQIRETIDADLTVEGDLRRETAMNIKRLMDLACYRGLRHRKGLPVRGQRTH
FT                   TNARTRKGKAKPIAGKKK"
     atggcacgta ttgcgggtgt caacatcccg accaacaagc gcgtgatcat cgcgctcacc        60
     tacatccacg gcatcggccg caagaccgcc gtcgacatcg ccgacaagct gggcatcgac       120
     cacagccgcc gcgtccagga cctgtccgac gccgaagtgc tgcagatccg cgagacaatc       180
     gacgccgacc tgacggtcga gggcgacctg cgccgcgaga ccgcgatgaa catcaagcgg       240
     ctgatggacc tggcctgcta tcgcggcctg cgccatcgca agggcctgcc ggtccgcggc       300
     cagcgcacgc acaccaatgc gcgcacccgc aagggcaagg cgaagccgat cgccggcaag       360
     aagaagtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page