(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSQ

AP010803.RPSQ        Location/Qualifiers
FT   CDS_pept        648171..648434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SJA_C1-06360"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95470"
FT                   /db_xref="GOA:D4YYN8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN8"
FT                   /protein_id="BAI95470.1"
FT                   /translation="MPKRVLTGTVVSDKTDKTVVVRVERKVKHALYGKIIRRSKKYHAH
FT                   DEGNVYKEGETVRIEETAPISKLKTWKVIERVDTHKSPETAA"
     atgcccaagc gcgtgctgac gggaacggtg gtttccgaca agaccgacaa gacggtggtg        60
     gttcgcgtgg agcgcaaggt taagcatgcg ctctacggca agatcatccg ccgttcgaag       120
     aagtaccatg cccatgacga gggcaatgtc tacaaggaag gcgaaacggt ccgcatcgag       180
     gagaccgctc cgatttccaa gctcaagacc tggaaggtca tcgagcgcgt ggacacccac       240
     aagtcgccgg aaacggcggc ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page