(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSS

AP010803.RPSS        Location/Qualifiers
FT   CDS_pept        646137..646415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SJA_C1-06310"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95465"
FT                   /db_xref="GOA:D4YYN3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN3"
FT                   /protein_id="BAI95465.1"
FT                   /translation="MARSVWKGPFVDLSLLKKAEVAQDAGGRSGPIKTWSRRSTILPQF
FT                   VGLTFNVYNGRKHVPVSVNEDMVGHKLGEFAPTRYFPGHAADKKGKR"
     atggctcgtt ccgtctggaa aggtccgttc gtggacctca gccttctgaa gaaggcggaa        60
     gtcgctcagg atgccggtgg ccgttcgggt ccgatcaaga cctggtcgcg ccgttccacc       120
     atcctgccgc agttcgtcgg cctgacgttc aacgtctata acggccgcaa gcatgtgccg       180
     gtctcggtga acgaggacat ggtgggtcac aagctgggcg aattcgcccc gacccgctac       240
     ttccccggcc acgccgccga caagaagggc aagcgctaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page