(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSU

AP010803.RPSU        Location/Qualifiers
FT   CDS_pept        667675..667881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="SJA_C1-06620"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95496"
FT                   /db_xref="GOA:D4YYR4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR4"
FT                   /protein_id="BAI95496.1"
FT                   /translation="MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAR
FT                   EKAAAVRRARKLERKRAERDGVR"
     atgcaaatca tcgttcgcga caacaatgtc gaccaggccc tgcgcgcgct caagaagaag        60
     ctgcagcgcg agggcgtgta tcgcgagatg aagctgcgcc gtcattatga gaagccctcg       120
     gaaaagcgcg cccgcgaaaa ggccgccgcc gttcgccgcg cccgcaagct ggagcgcaag       180
     cgcgccgagc gcgacggcgt ccgttaa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page