(data stored in SCRATCH zone)

EMBL: AP010803.RUVA

AP010803.RUVA        Location/Qualifiers
FT   CDS_pept        101048..101656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SJA_C1-00990"
FT                   /product="Holliday junction resolvasome DNA-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94933"
FT                   /db_xref="GOA:D4YX51"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX51"
FT                   /protein_id="BAI94933.1"
FT                   /translation="MIAKLKGRLDSTGLDHAIIDVGGVGYLVGASSRTLAALGPVGEAV
FT                   TVHTEMLVSDDAIRLVGFARAEERDWFRLLTGVQGVGSRVALAILSALEPVELHRAVAA
FT                   GDKAMIARANGVGPKLAQRIANELKDKIGAAPMPAGAVGAGFAALPTGGHSADAISALQ
FT                   NLGFKPAEASIAVAAAEEELGEDASLDALVRLALRKAAK"
     atgatcgcga aactgaaagg acggctggac agcacgggcc tggaccatgc catcatcgat        60
     gtgggcgggg tcggctatct ggtcggcgct tcttcccgca cgctcgcggc gctggggccg       120
     gtgggcgaag cggtgacggt ccacaccgaa atgctggtgt cggacgatgc gatccgcctg       180
     gtcggcttcg cccgggcgga ggagcgcgac tggttccgcc tgctgaccgg cgtgcagggc       240
     gtgggttccc gcgtggcgct ggccatcctc tccgcgctgg aaccggtgga actgcaccgc       300
     gccgtggcgg ccggcgacaa ggcgatgatc gcccgcgcca acggcgtggg tcccaagctt       360
     gcccaacgca tcgccaatga attgaaggac aagatcggcg cggcgcccat gccggccggg       420
     gcggtcggcg ccgggtttgc ggcgctgccc accggcggcc acagcgccga tgcgatctcg       480
     gccctccaga atctgggctt caagcctgcc gaagccagca tcgccgtcgc cgccgccgaa       540
     gaggaactgg gcgaagacgc gtcgctggat gcgctggtgc gcctggcgct caggaaagcg       600
     gcgaaatga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page